Integrin Alpha V Recombinant monoclonal antibody, PBS Only

Name: Integrin Alpha V Recombinant monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 84883-3-PBS-100UG

Integrin Alpha V Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84883-3-PBS

Clone No.242376D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

ITGAV, CD51, Integrin alpha-V, Integrin alpha-V heavy chain, Integrin alpha-V light chain

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllSDS-PAGEAffinity

SDS-PAGE of 84883-3-RR
Purity of Integrin Alpha V Recombinant monoclonal antibody （84883-3-RR） was determined by SDS-PAGE. The antibody was resolved in an SDS-PAGE in reducing (R) and non-reducing (NR) conditions and stained using Coomassie blue.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 84883-3-RR
Biolayer interferometry (BLl) kinetic assays of 84883-3-RR against Human Integrin Alpha V were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

84883-3-PBS targets Integrin Alpha V in Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag25825 Product name: Recombinant human ITGAV protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 819-915 aa of BC136442 Sequence: SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ Predict reactive species
Full Name	integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)
Calculated Molecular Weight	1048 aa, 116 kDa
GenBank Accession Number	BC136442
Gene Symbol	Integrin alpha V
Gene ID (NCBI)	3685
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P06756
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.