Centromere protein R Polyclonal antibody

• 

  WB analysis of K-562 using 10743-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10743-1-AP (Centromere protein R antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 10743-1-AP

  IP result of anti-Centromere protein R (IP:10743-1-AP, 4ug; Detection:10743-1-AP 1:300) with K-562 cells lysate 2400 ug.

• 

  IHC staining of human skin cancer using 10743-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 10743-1-AP (Centromere protein R antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 10743-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using Centromere protein R antibody (10743-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

Centromere protein R Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10743-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ITGB3BP, HSU37139, CENP-R, CENPR, CENP R

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IF: See 4 publications below
• IP: See 3 publications below

Product Information

10743-1-AP targets Centromere protein R in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1204

  Product name: Recombinant human Centromere protein R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-177 aa of BC009929

  Sequence: MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN

• Full Name: integrin beta 3 binding protein (beta3-endonexin)
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC009929
• Gene Symbol: ITGB3BP
• Gene ID (NCBI): 23421
• RRID: AB_2128916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13352
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITGB3BP, also named as CENPR and NRIF3; is a transcription coregulator that can have both coactivator and corepressor functions. ITGB3BP acts as a coactivator for estrogen receptor alpha. It acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. ITGB3BP induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. ITGB3BP has five isoforms with MW 7 kDa, 13 kDa and 19-25 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF,IP	Cancer Res; Identification of a novel pathway that selectively modulates apoptosis of breast cancer cells.; Authors - Tinnikov Alexander A AA
human	IF,WB,IP	J Mol Cell Biol; Phosphorylation of CENP-R by Aurora B regulates kinetochore-microtubule attachment for accurate chromosome segregation; Authors - Divine Mensah ; KD Validated
human	WB	Oncogene; Serine 28 phosphorylation of NRIF3 confers its co-activator function for estrogen receptor-alpha transactivation.; Authors - Talukder A H AH
human	WB	Stem Cells Transl Med; LncRNA NR_045147 modulates osteogenic differentiation and migration in PDLSCs via ITGB3BP degradation and mitochondrial dysfunction; Authors - Lujue Long
human	IF	J Cell Biol; Interactions with multiple inner kinetochore proteins determine mitotic localization of FACT; Authors - Julia Schweighofer
human	WB,IP,IF	Cell Rep; Condensation-dependent multivalent interactions of EB1 and CENP-R regulate chromosome oscillations in mitosis; Authors - Chengcheng Hu