Integrin Beta 6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Integrin Beta 6 Polyclonal antibody (21703-1-AP)

Integrin Beta 6 Polyclonal Antibody for IHC, ELISA

Cat No. 21703-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

ITGB6, Integrin beta-6, integrin, beta 6

• 

  IHC staining of human pancreas cancer using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 21703-1-AP (Integrin beta-6 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 21703-1-AP (Integrin beta-6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21703-1-AP (Integrin Beta 6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21703-1-AP (Integrin Beta 6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21703-1-AP (Integrin Beta 6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21703-1-AP (Integrin Beta 6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Integrin Beta 6 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human ovary tumor tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21703-1-AP targets Integrin Beta 6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16319

  Product name: Recombinant human Integrin beta-6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 139-434 aa of BC121178

  Sequence: MDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHII

• Full Name: integrin, beta 6
• Calculated Molecular Weight: 788 aa, 86 kDa
• GenBank Accession Number: BC121178
• Gene Symbol: Integrin beta 6
• Gene ID (NCBI): 3694
• RRID: AB_2878906
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18564
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITGB6 belongs to the integrin beta chain family. ITGB6 is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. Internalisation of integrin alpha-V/beta-6 via clathrin-mediated endocytosis promotes carcinoma cell invasion.

Publications

What published studies show

The Integrin Beta 6 Polyclonal antibody (Cat# 21703-1-AP) has 1 citation to date. The cited publication appeared in the journal Toxicology (Impact Factor 5.2), published in 2026. The research field is toxicology, specifically examining ITGB6 expression and function in porcine intestinal epithelial cells upon deoxynivalenol exposure, using Western blot as the application with knockout cell controls.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Toxicology; Analysis of the expression and function of ITGB6 in porcine intestinal epithelial cells upon deoxynivalenol exposure.; Authors - Haifei Wang ; KO Validated