Integrin Beta 6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Integrin Beta 6 Polyclonal antibody (21703-1-AP)

Integrin Beta 6 Polyclonal Antibody for IHC, ELISA

Cat No. 21703-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

ITGB6, Integrin beta-6, integrin, beta 6

• 

  IHC staining of human pancreas cancer using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 21703-1-AP (Integrin beta-6 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 21703-1-AP (Integrin beta-6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21703-1-AP (Integrin Beta 6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21703-1-AP (Integrin Beta 6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21703-1-AP (Integrin Beta 6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 21703-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21703-1-AP (Integrin Beta 6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human ovary tumor tissue, human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21703-1-AP targets Integrin Beta 6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16319

  Product name: Recombinant human Integrin beta-6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 139-434 aa of BC121178

  Sequence: MDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHII

• Full Name: integrin, beta 6
• Calculated Molecular Weight: 788 aa, 86 kDa
• GenBank Accession Number: BC121178
• Gene Symbol: Integrin beta 6
• Gene ID (NCBI): 3694
• RRID: AB_2878906
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P18564
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITGB6 belongs to the integrin beta chain family. ITGB6 is a receptor for fibronectin and cytotactin. It recognizes the sequence R-G-D in its ligands. Internalisation of integrin alpha-V/beta-6 via clathrin-mediated endocytosis promotes carcinoma cell invasion.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Toxicology; Analysis of the expression and function of ITGB6 in porcine intestinal epithelial cells upon deoxynivalenol exposure.; Authors - Haifei Wang ; KO Validated