Integrin Beta 7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Integrin Beta 7 Polyclonal antibody (11328-1-AP)

Integrin Beta 7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11328-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

Integrin beta-7, ITGB7, integrin, beta 7

• 

  WB analysis of THP-1 using 11328-1-AP

  THP-1 cells were subjected to SDS PAGE followed by western blot with 11328-1-AP (Integrin Beta 7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human lung using 11328-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11328-1-AP (ITGB7 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 11328-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11328-1-AP (ITGB7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 11328-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11328-1-AP (Integrin Beta 7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 11328-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11328-1-AP (Integrin Beta 7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: THP-1 cells, human lung tissue, K-562 cells
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11328-1-AP targets Integrin Beta 7 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1871

  Product name: Recombinant human Integrin beta-7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 499-798 aa of BC015916

  Sequence: VCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGKGHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGDMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTGPLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKSAITTTINPRFQEADSPTL

• Full Name: integrin, beta 7
• Calculated Molecular Weight: 798 aa, 87 kDa
• Observed Molecular Weight: 87-100 kDa
• GenBank Accession Number: BC015916
• Gene Symbol: Integrin beta 7
• Gene ID (NCBI): 3695
• RRID: AB_2249380
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P26010
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITGB7 (integrin, beta7) is a single-pass type I membrane protein that belongs to the integrin beta chain family. The integrins are a large family of cell-surface glycoprotein receptors that play key roles in leucocyte adhesion, signalling, proliferation and migration by binding as heterodimers to specific ligands. The beta7 integrin associates with alpha4 integrin to form a heterodimer, alpha4/beta7, which interacts with MADCAM1, VCAM, fibronectin, and may also interact with HIV-1 gp120. The beta7 integrin can also form a heterodimer with alphaE integrin, and the dimer, alphaE/beta7 integrin, is a receptor for E-cadherin. ITGB7 is expressed in a variety of leukocyte lines.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Hum Reprod; Expression of adhesion, attachment and invasion markers in eutopic and ectopic endometrium: a link to the aetiology of endometriosis.; Authors - Sundqvist J J
	IF	J Biol Chem; Multifunctional activity of a small tellurium redox immunomodulator compound, AS101, on DSS-induced murine colitis.; Authors - Gilad Halpert
human	WB	Cell Commun Signal; Inhibition of the Otub1/c-Maf axis by the herbal acevaltrate induces myeloma cell apoptosis.; Authors - Tong Sun
	WB	Arthritis Res Ther; Sirt3 improves monosodium urate crystal-induced inflammation by suppressing Acod1 expression; Authors - Linxi Lv
	WB	J Ethnopharmacol; Dan'e fukang decoction reduces hemorrhage in a rat model of mifepristone induced incomplete abortion and may correlate with cell adhesion molecule signaling interference; Authors - Qi-Cheng Ni
human	IF	Cell Mol Gastroenterol Hepatol; Cholinergic anti-inflammatory pathway attenuates Acute Liver Failure through Inhibiting MAdCAM1/α4β7 -Mediated Gut-derived proinflammatory lymphocytes accumulation; Authors - Shan Fu