ITM2B Polyclonal antibody

• 

  WB analysis using 12193-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12193-1-AP (ITM2B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12193-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12193-1-AP (ITM2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

ITM2B Polyclonal Antibody for WB, ELISA

Cat No. 12193-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ABRI, Bri, BRI2, BRI2 intracellular domain, BRI2, membrane form

---

Tested Applications

• Positive WB detected in: U-251 cells, fetal human brain tissue, U-251 cells unboiled

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12193-1-AP targets ITM2B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2831

  Product name: Recombinant human ITM2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-266 aa of BC016148

  Sequence: MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS

• Full Name: integral membrane protein 2B
• Calculated Molecular Weight: 266 aa, 30 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC016148
• Gene Symbol: ITM2B
• Gene ID (NCBI): 9445
• RRID: AB_3669134
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y287
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ITM2B plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. It plays a role in the induction of neurite outgrowth and functions as a protease inhibitor by blocking access of secretases to APP cleavage sites.