Icln Polyclonal antibody

• 

  WB analysis of HEK-293 using 25964-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25964-1-AP (Icln antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MDCK using 25964-1-AP

  MDCK cells were subjected to SDS PAGE followed by western blot with 25964-1-AP (Icln antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 25964-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HEK-293 cells using 25964-1-AP (Icln antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

Icln Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25964-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, Canine

Applications

WB, IF/ICC, ELISA

Synonyms

CLCI, CLNS1A, CLNS1B, I(Cln), ICln, Methylosome subunit pICln, pICln, Reticulocyte pICln

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MDCK cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25964-1-AP targets Icln in WB, IF/ICC, ELISA applications and shows reactivity with human, Canine samples.

• Tested Reactivity: human, Canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22923

  Product name: Recombinant human CLNS1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC119634

  Sequence: MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH

• Full Name: chloride channel, nucleotide-sensitive, 1A
• Calculated Molecular Weight: 237 aa, 26 kDa
• Observed Molecular Weight: 36-42 kDa
• GenBank Accession Number: BC119634
• Gene Symbol: CLNS1A
• Gene ID (NCBI): 1207
• RRID: AB_2880312
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54105
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.