Pig IgD Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Pig IgD Recombinant monoclonal antibody (87737-1-RR)

Pig IgD Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87737-1-RR

Clone No.253406C11

Host / Isotype

Rabbit / IgG

Reactivity

pig

Applications

WB, ELISA

Synonyms

Immunoglobulin D

• 

  WB analysis using 87737-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87737-1-RR (Pig IgD antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87737-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87737-1-RR against Pig IgD were performed. The affinity constant is 0.22 nM.

---

Tested Applications

• Positive WB detected in: pig spleen tissue, pig serum sample

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87737-1-RR targets Pig IgD in WB, ELISA applications and shows reactivity with pig samples.

• Tested Reactivity: pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg7410

  Product name: Recombinant Pig IgD protein (His Tag)

  Source: mammalian cells-derived, V37

  Tag: C-6*His

  Domain: 102-400 aa of /

  Sequence: ISGPASRQLPAPAGTPGPTLSTVSTKALTTPRIPVRSTVRGQPGAQTQEPPEGPRGACQNHTRPPSVYLLLPPLQGLWLRAEATFTCLAVGQDLQEARLSWAVAEEPQGGRMEEGPTEHTNGSWSLSSRLALPRSSWAAGAPVTCRLSGPGLRSLVTAEARREHAALAPSNLAVRVLTAPGPLAFTKAASWLLCEVSSFSPLDILLTWLEGQQEVDPSWFATARPAAQPGNPTFRTWSVLRVPASPGHQDATYTCVVGHEASRTLLNASWRLDTGPLLIQQRLGAEWKASKRAPASPEA

• Full Name: Pig IgD
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 75 kDa and 25 kDa
• GenBank Accession Number: /
• Gene ID (NCBI): /
• RRID: AB_3745724
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: K7ZRJ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Immunoglobulin D (IgD) is an antibody class primarily functioning as a membrane-bound receptor on the surface of naïve B cells. Comprising less than 1% of serum immunoglobulins, IgD exists mainly in a transmembrane form that co-expresses with IgM on mature B lymphocytes. It plays a crucial role in B cell activation, survival, and immune surveillance by sensing environmental antigens and regulating humoral immune responses. Recent studies reveal IgD's involvement in mucosal immunity and its ability to bind to basophils and mast cells, triggering antimicrobial defense. Structurally, IgD features an extended hinge region, making it susceptible to proteolytic cleavage. Despite being discovered in 1965, IgD's precise functions remain an active area of immunological research. The immunogen for this antibody is Eg7410, and the immunogen sequence targets the Fc region of porcine IgD.