Integrin alpha 1 Monoclonal antibody

Integrin alpha 1 Monoclonal Antibody for WB, IF-P, ELISA
Cat No. 68211-1-Ig
Clone No.1C4F2

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IF-P, ELISA

ITGA1, Laminin and collagen receptor, integrin, alpha 1, CD49a, CD49 antigen-like family member A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, human placenta tissue
Positive IF-P detected inhuman placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68211-1-Ig targets Integrin alpha 1 in WB, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30631

Product name: Recombinant human Integrin alpha-1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 980-1141 aa of BC137121

Sequence: GNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDISQVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRVP

Predict reactive species
Full Name integrin, alpha 1
Calculated Molecular Weight 1179 aa, 131 kDa
Observed Molecular Weight180 kDa
GenBank Accession NumberBC137121
Gene Symbol Integrin alpha 1
Gene ID (NCBI) 3672
RRIDAB_2935299
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56199
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha-1 (ITGA1, CD49a) combines with the beta 1 subunit (ITGB1, CD29) to form a cell-surface receptor for collagen and laminin. This receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. Integrin alpha-1 is a transmembrane glycoprotein with an apparent molecular weight of 180-250 kDa, larger than the calculated molecular weight of 131 kDa (PMID: 2475259; 3257425; 11557277; 18840653).

Protocols

Product Specific Protocols
IF protocol for Integrin alpha 1 antibody 68211-1-IgDownload protocol
WB protocol for Integrin alpha 1 antibody 68211-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...