Tested Applications
| Positive WB detected in | HT-1080 cells, A431 cells, HeLa cells, MDA-MB-231 cells |
| Positive IHC detected in | human colon cancer Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30703-1-AP targets CD49b in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32771 Product name: Recombinant human ITGA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 840-1132 aa of NM_002203 Sequence: GIVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSIVHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCNADINPLKIGQTSSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPT Predict reactive species |
| Full Name | integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) |
| Calculated Molecular Weight | 126 kDa |
| Observed Molecular Weight | 140-150 kDa |
| GenBank Accession Number | NM_002203 |
| Gene Symbol | Integrin alpha 2 |
| Gene ID (NCBI) | 3673 |
| RRID | AB_3669752 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17301 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha-2 (ITGA2, CD49b) combines with the beta 1 subunit (ITGB1, CD29) to form a cell-surface receptor (VLA-2) for laminin, collagen, collagen C-propeptides, fibronectin and E-cadherin.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD49b antibody 30703-1-AP | Download protocol |
| IHC protocol for CD49b antibody 30703-1-AP | Download protocol |
| WB protocol for CD49b antibody 30703-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD49b Polyclonal antibody (catalog number 30703-1-AP) has 6 total citations. These appear in Nature Communications, Biomaterials, International Journal of Biological Macromolecules, European Journal of Medical Research, Molecular Oncology, and the FASEB Journal. The associated research fields span 3D tissue engineering and synthetic cell integration, urethral stricture reconstruction, gastric cancer immune checkpoint analysis, pulmonary arterial smooth muscle dysfunction, melanoma adhesion and metastasis, and influenza antiviral mechanisms. Most studies applied the antibody for Western blot and immunofluorescence in human samples.
| Species | Application | Title |
|---|---|---|
Nat Commun Self-assembly of hybrid 3D cultures by integrating living and synthetic cells. | ||
Biomaterials Tannic acid-reinforced anisotropic polyvinyl alcohol hydrogel for urethral stricture reconstruction. | ||
Int J Biol Macromol Multi-omic analysis reveals the role of coagulation factor family genes and their predictive value for immune checkpoint inhibitors efficacy in gastric cancer. | ||
Eur J Med Res Targeting CircNLRP12 attenuates hypoxia-induced pulmonary arterial smooth muscle cell dysfunction by sponging miR-107-5p and suppressing the ITGA2-mediated FAK/PI3K/AKT pathway. | ||
FASEB J TurboID-Based Proximity Labeling Map Reveals the Protein Interaction Network and Anti-Viral Mechanism Against Influenza A H1N1. |
