Integrin Alpha 7 Polyclonal antibody

• 

Integrin alpha-7 Polyclonal Antibody for ELISA

Cat No. 23260-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

Integrin alpha 7, integrin, alpha 7, ITGA7

---

Product Information

23260-1-AP targets Integrin alpha-7 in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19777

  Product name: Recombinant human Integrin alpha-7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 36-351 aa of BC050280

  Sequence: LDVMGALRKEGEPGSLFGFSVALHRQLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGLLFVTNIDSSDPDQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEEL

• Full Name: integrin, alpha 7
• Calculated Molecular Weight: 1181 aa, 129 kDa
• GenBank Accession Number: BC050280
• Gene Symbol: Integrin alpha 7
• Gene ID (NCBI): 3679
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q13683
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.