Integrin alpha-9 Polyclonal antibody

Integrin alpha-9 Polyclonal Antibody for WB, ELISA
Cat No. 28348-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

WB, ELISA

ALPHA RLC, Integrin alpha 9, Integrin alpha RLC, Integrin alpha-9, integrin, alpha 9, ITGA4L, ITGA9, RLC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28348-1-AP targets Integrin alpha-9 in WB, ELISA applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28815

Product name: Recombinant human Integrin alpha-9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 462-613 aa of BC030198

Sequence: VITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPEEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMGQVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQ

Predict reactive species
Full Name integrin, alpha 9
Calculated Molecular Weight 114 kDa
Observed Molecular Weight135 kDa
GenBank Accession NumberBC030198
Gene Symbol Integrin alpha 9
Gene ID (NCBI) 3680
RRIDAB_3669655
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13797
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits (PMID: 9779984). Integrin alpha 9 contains a large N-terminal extracellular domain with 7 conserved repeats of putative metal-binding domains, a transmembrane segment, and a short C-terminal cytoplasmic tail (PMID: 8245132). Integrin alpha 9 interacts with integrin beta 1 generating α9β1 heterodimer, which is expressed in many cell types including epithelial cells, neutrophils, hepatocytes, muscle and endothelial cells (PMID: 21975548). It binds to a diversity of ligands in the extracellular matrix, like the a-disintegrin and metalloprotease (ADAM) family, THBS1, EMILIN1, VEGF, tenascin-C, osteopontin, fibronectin, and VCAM1 (PMID: 21975548; 33790909). Integrin α9β1 has been implicated in diverse biological functions including angiogenesis, lymphangiogenesis, lymphatic valve morphogenesis, granulopoiesis and tumorigenesis (PMID: 20179422).

Protocols

Product Specific Protocols
WB protocol for Integrin alpha-9 antibody 28348-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...