Integrin beta-8 Recombinant monoclonal antibody, PBS Only

Integrin beta-8 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 84558-1-PBS
Clone No.241549A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

ITGB8, integrin, beta 8, Integrin beta 8, 241549A12

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84558-1-PBS targets Integrin beta-8 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag31161

Product name: Recombinant human Integrin beta-8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 460-620 aa of NM_002214

Sequence: KIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSI

Predict reactive species
Full Name integrin, beta 8
Calculated Molecular Weight 86 kDa
Observed Molecular Weight95-100 kDa
GenBank Accession NumberNM_002214
Gene Symbol Integrin beta 8
Gene ID (NCBI) 3696
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP26012
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin beta-8 (ITGB8), belongs to the integrin beta chain family, contains an N-terminal signal peptide, a large extracellular domain that includes four cysteine-rich repeats, a transmembrane domain, and a C-terminal cytoplasmic domain (PMID: 1918072). Integrin beta-8 associates with integrin alpha-V (ITGAV) to form an αvβ8 heterodimer which has been shown to bind vitronectin, fibronectin, and a latency-associated peptide of TGF-β1/3 (PMID: 27033701). Integrin beta-8 contains multiple potential N-linked glycosylation sites. The observed molecular mass of approximately 95-100 kDa for integrin beta-8 is larger than the predicted 86 kDa, consistent with substantial glycosylation (PMID: 1918072).

Loading...
||
New chat Able
正在加载,请稍候...