JAB1 Recombinant monoclonal antibody

• 

  WB analysis using 87012-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87012-1-RR (JAB1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 87012-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87012-1-RR against Human JAB1 were performed. The affinity constant is below 1 pM.

JAB1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87012-1-RR

Clone No.252139B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

COPS5, CSN5, EC:3.4.-.-, Jun activation domain-binding protein 1, MOV 34

---

Tested Applications

• Positive WB detected in: HeLa cells, U-87 MG cells, MCF-7 cells, HCT 116 cells, HEK-293 cells, NIH/3T3 cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87012-1-RR targets JAB1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25950

  Product name: Recombinant human JAB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC001187

  Sequence: MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS

• Full Name: COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis)
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC001187
• Gene Symbol: JAB1
• Gene ID (NCBI): 10987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92905
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex. Promotes the proteasomal degradation of BRSK2.