JAGN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• JAGN1 Polyclonal antibody (34193-1-AP)

• 

  WB analysis using 34193-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34193-1-AP (JAGN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 34193-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 34193-1-AP (JAGN1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 34193-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 34193-1-AP (JAGN1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

JAGN1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 34193-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Protein jagunal homolog 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, PC-3 cells, C6 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34193-1-AP targets JAGN1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40789

  Product name: Recombinant human JAGN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-39 aa of BC032101

  Sequence: MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKK

• Full Name: jagunal homolog 1 (Drosophila)
• Calculated Molecular Weight: 183 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC032101
• Gene Symbol: JAGN1
• Gene ID (NCBI): 84522
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N5M9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Jagunal homolog 1 (JAGN1) is an evolutionarily conserved endoplasmic reticulum (ER) membrane protein essential for neutrophil differentiation and function. First identified in Drosophila for its role in ER organization, human JAGN1 mutations cause severe congenital neutropenia type 5, characterized by recurrent infections due to impaired granulocyte development. JAGN1 regulates glycoprotein folding, ER-Golgi trafficking, and N-glycosylation of proteins critical for neutrophil viability. Loss of JAGN1 leads to ER stress, apoptosis of myeloid progenitors, and defective neutrophil migration. Its indispensable role in innate immunity highlights JAGN1 as a potential therapeutic target for neutropenia and immunodeficiency disorders (PMID: 25129144; 37120535; 33207009; 38739706).