JAK1 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• JAK1 Recombinant monoclonal antibody, PBS Only (Detector) (88294-2-PBS)

JAK1 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 88294-2-PBS

Clone No.260802E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

• 

  Sandwich ELISA sample test of MP03525-1

  The mean JAK1 concentration was determined to be 248.19 ng/mL in ACHN cell extract based on a 1.50 mg/mL extract load, 180.36 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load and 6.45 ng/mL in LNCaP cell extract based on a 1.20 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP03525-1

  The mean JAK1 concentration was determined to be 247.18 ng/mL in Daudi cell extract based on a 1.20 mg/mL extract load, 94.81 ng/mL in MOLT-4 cell extract based on a 1.20 mg/mL extract load and 114.53 ng/mL in Jurkat cell extract based on a 1.20 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP03525-1

  Sandwich ELISA standard curve of MP03525-1, Human JAK1 Recombinant Matched Antibody Pair - PBS only. 88294-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag25579. 88294-2-PBS was HRP conjugated as the detection antibody. Range: 0.195-12.5 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88294-2-PBS targets JAK1 as part of a matched antibody pair:

MP03525-1: 88294-3-PBS capture and 88294-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25579

  Product name: Recombinant human JAK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1080-1151 aa of BC132729

  Sequence: SDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEA

• Full Name: Janus kinase 1 (a protein tyrosine kinase)
• Calculated Molecular Weight: 1154 aa, 133 kDa
• GenBank Accession Number: BC132729
• Gene Symbol: JAK1
• Gene ID (NCBI): 3716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23458
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.