JAK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• JAK2 Polyclonal antibody, PBS Only (17670-1-PBS)

• 

  WB analysis of NIH/3T3 using 17670-1-AP (same clone as 17670-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 17670-1-AP (JAK2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17670-1-PBS in a different storage buffer formulation.

• 

  IP experiment of NIH/3T3 using 17670-1-AP (same clone as 17670-1-PBS)

  IP result of anti-JAK2 (IP:17670-1-AP, 4ug; Detection:17670-1-AP 1:300) with NIH/3T3 cells lysate 3440 ug. This data was developed using the same antibody clone with 17670-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17670-1-AP (same clone as 17670-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17670-1-AP (JAK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17670-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17670-1-AP (same clone as 17670-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17670-1-AP (JAK2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17670-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 17670-1-AP (same clone as 17670-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17670-1-AP (JAK2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17670-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 17670-1-AP (same clone as 17670-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17670-1-AP (JAK2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17670-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

JAK2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 17670-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

Tyrosine protein kinase JAK2, JTK10, Janus kinase 2, JAK-2, JAK 2

---

Product Information

17670-1-PBS targets JAK2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11264

  Product name: Recombinant human JAK2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 764-1129 aa of BC039695

  Sequence: EDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG

• Full Name: Janus kinase 2 (a protein tyrosine kinase)
• Calculated Molecular Weight: 1132 aa, 130 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC039695
• Gene Symbol: JAK2
• Gene ID (NCBI): 3717
• RRID: AB_2811138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60674
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Janus kinases (JAKs) are non-receptor tyrosine kinases that are activated by cytokine binding to cytokine receptors resulting in stimulation of the JAK-STAT signaling pathway. Aberrant activation of this signaling pathway is associated with numerous immune disorders and cancer.