Important Customer Notice Regarding Covid-19 Outbreak. Read more.

JAK2 Fusion Protein

Catalog number: Ag11264

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

JAK2 fusion protein Ag11264 SDS-PAGE


Product Name:
human JAK2-6*His fusion protein

Catalog No:
Ag11264

Source:
E. coli-derived, PET28a

Peptide Sequence:
EDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
(764-1129 aa encoded by BC039695)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top