JAM3 Polyclonal antibody

• 

  WB analysis using 32424-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32424-1-AP (JAM3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 32424-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 32424-1-AP (JAM3 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

JAM3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32424-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

JAM-2, JAM-3, JAM-C, Junctional adhesion molecule 3, Junctional adhesion molecule C

---

Tested Applications

• Positive WB detected in: A375 cells, Jurkat cells, SH-SY5Y cells, SK-N-SH cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32424-1-AP targets JAM3 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35750

  Product name: Recombinant human JAM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 32-241 aa of NM_032801.4

  Sequence: VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN

• Full Name: junctional adhesion molecule 3
• Calculated Molecular Weight: 35 kDa，310aa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_032801.4
• Gene Symbol: JAM3
• Gene ID (NCBI): 83700
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BX67
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Junctional adhesion molecule 3 (JAM3) is a type I transmembrane glycoprotein containing two Ig-like domains, which is expressed in various tissues and plays a crucial role in cell junctions, cell polarity, and motility (PMID: 34292449; 28931565). It has been proposed that JAM3 participates in leukocyte-platelet interactions, as well as angiogenesis and brain development (PMID: 12208882; 23255084). JAM3 may also be a new marker for predicting the prognosis and immune functions of bladder cancer patients (PMID: 38400838).