Product Information
33929-1-PBS targets JKAMP in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag40886 Product name: Recombinant human C14orf100 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC010359 Sequence: MAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD Predict reactive species |
| Full Name | chromosome 14 open reading frame 100 |
| Calculated Molecular Weight | 311 aa, 35 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC010359 |
| Gene Symbol | C14orf100 |
| Gene ID (NCBI) | 51528 |
| RRID | AB_3743114 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9P055 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
JKAMP (JNK1/MAPK8-Associated Membrane Protein) is a multi-pass transmembrane protein primarily found in the endoplasmic reticulum (ER) and plasma membrane. JKAMP plays a critical role in cellular stress responses by regulating the duration of JNK1 (MAPK8) activity. It competes with phosphatases like MKP5 to sustain JNK1 signaling, thereby influencing stress-induced apoptosis. Additionally, JKAMP is involved in the ubiquitin-dependent ER-associated degradation (ERAD) pathway, helping to degrade misfolded ER proteins by recruiting proteasomal components.

