JPH4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• JPH4 Polyclonal antibody, PBS Only (32471-1-PBS)

• 

  WB analysis using 32471-1-AP (same clone as 32471-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32471-1-AP (JPH4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32471-1-PBS in a different storage buffer formulation.

JPH4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32471-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

KIAA1831, Junctophilin-like 1 protein, Junctophilin-4, JPHL1, JP-4

---

Product Information

32471-1-PBS targets JPH4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38425

  Product name: Recombinant human JPH4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 450-600 aa of NM_001146028.1

  Sequence: GLTPSEGSPELPSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEEGEDEEPLPPLRAPAGTEPEPIAMLVLRGSSSRGPDAGCLTEELGEPAATERPAQ

• Full Name: junctophilin 4
• Calculated Molecular Weight: 66kDa，628aa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001146028.1
• Gene Symbol: JPH4
• Gene ID (NCBI): 84502
• RRID: AB_3742622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96JJ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

JPH4 (Junctophilin 4) is a member of the junctophilin family of transmembrane proteins. JPH4 is involved in the formation of junctional membrane complexes between the plasma membrane and the endoplasmic/sarcoplasmic reticulum in excitable cells. It plays a crucial role in maintaining the structural integrity and function of these complexes. JPH4 is biased in expression in the brain (RPKM 34.3) and endometrium (RPKM 8.7), among other tissues.