Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, K-562 cells, NIH/3T3 cells, rat liver tissue, L02 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse cerebellum tissue, human kidney tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10424-1-AP targets JTV1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0675 Product name: Recombinant human JTV1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC002853 Sequence: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS Predict reactive species |
| Full Name | JTV1 gene |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC002853 |
| Gene Symbol | JTV1 |
| Gene ID (NCBI) | 7965 |
| RRID | AB_513880 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13155 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
JTV1, also named p38, AIMP2, was first knew as a factor associated with macromolecular protein complex, which consists several different aminoacyl-tRNA synthetases. JTV1 is a scaffold protein required for the assembly and stability of the multi-tRNA synthetase complex. JTV1 could act as a mediator of TGF-beta signaling and its functional importance in the control of MYC during lung differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor. This is a rabbit polyclonal antibody raised against full-length of JTV1. There're two isoforms of JTV1 with MW about 27 kDa and 35 kDa,
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for JTV1 antibody 10424-1-AP | Download protocol |
| IHC protocol for JTV1 antibody 10424-1-AP | Download protocol |
| IP protocol for JTV1 antibody 10424-1-AP | Download protocol |
| WB protocol for JTV1 antibody 10424-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The JTV1 (AIMP2/p38) Polyclonal antibody (Cat# 10424-1-AP) has 30 citations. These appear in journals including Nature, Nature Neuroscience, Nature Communications, Molecular Cell, PNAS, Cell Death & Disease, Oncogene, Journal of Biological Chemistry, iScience, and Journal of Virology. Research fields span Parkinson's disease and neurodegeneration, cancer (hepatocellular, breast, ovarian), autophagy, the multi-tRNA synthetase complex, virology, and metabolism. Applications cited include WB, IF, IHC, IP, and CoIP.
| Species | Application | Title |
|---|---|---|
Nat Neurosci Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss. | ||
Nat Commun Molecular determinants of selective clearance of protein inclusions by autophagy. | ||
Mol Cell A methyltransferase-independent role for METTL1 in tRNA aminoacylation and oncogenic transformation | ||
J Exp Clin Cancer Res RNA-binding protein CCDC137 activates AKT signaling and promotes hepatocellular carcinoma through a novel non-canonical role of DGCR8 in mRNA localization | ||
Cell Death Dis VPS35 regulates parkin substrate AIMP2 toxicity by facilitating lysosomal clearance of AIMP2. |
Reviews
What customers say
The single review for this antibody is highly positive, rated 5 stars. The user tested it on HEK293T cells for Western Blot and Immunoprecipitation, reporting it as a very strong antibody with no contaminant bands. Recommended dilutions were 1:2000 for WB and 1:100 for IP. Overall, the feedback highlights excellent specificity and clean signal performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
KRishnendu (Verified Customer) (02-27-2020) | Very strong antibody with no contaminant bands.
|
