JUN Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• JUN Recombinant monoclonal antibody, PBS Only (Capture) (81667-4-PBS)

JUN Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 81667-4-PBS

Clone No.252300B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

• 

  Cytometric bead array sample test of MP02901-1

  The mean JUN concentration was determined to be 15.4 ng/mL in HEK-293 nuclear cell extract based on a 1.0 mg/mL extract load, 4.2 ng/mL in HEK-293 cytoplasmic cell extract based on a 1.0 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP02901-1

  Cytometric bead array standard curve of MP02901-1, JUN Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 81667-4-PBS. Detection antibody: 81667-3-PBS. Standard: Ag17304. Range: 0.156-20 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 81667-4-PBS

  Biolayer interferometry (BLI) kinetic assay of 81667-4-PBS against Human JUN was performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

81667-4-PBS targets JUN as part of a matched antibody pair:

MP02901-1: 81667-4-PBS capture and 81667-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17304

  Product name: Recombinant human JUN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-227 aa of BC068522

  Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE

• Full Name: jun oncogene
• Calculated Molecular Weight: 331 aa, 36 kDa
• GenBank Accession Number: BC068522
• Gene Symbol: JUN
• Gene ID (NCBI): 3725
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05412
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.