JUNB Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84922-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 84922-2-PBS against Human JUNB was performed. The affinity constant is 0.636 nM.

JUNB Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84922-2-PBS

Clone No.242562F11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

AP 1, AP-1

---

Product Information

84922-2-PBS targets JUNB in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0752

  Product name: Recombinant human JUNB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC004250

  Sequence: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGA

• Full Name: jun B proto-oncogene
• Calculated Molecular Weight: 36 kDa
• GenBank Accession Number: BC004250
• Gene Symbol: JUNB
• Gene ID (NCBI): 3726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17275
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.