JUNB Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84922-6-RR (same clone as 84922-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84922-6-RR (JUNB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84922-6-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 84922-6-RR (same clone as 84922-6-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 84922-6-RR (JUNB antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84922-6-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84922-6-RR (same clone as 84922-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using JUNB antibody (84922-6-RR, Clone: 242562G2 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84922-6-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 84922-6-RR (same clone as 84922-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using JUNB antibody (84922-6-RR, Clone: 242562G2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84922-6-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 84922-6-RR (same clone as 84922-6-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug JUNB Recombinant antibody (84922-6-RR, Clone:242562G2) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 84922-6-PBS in a different storage buffer formulation.

• 

  ChIP experiment of PC-12 using 84922-6-RR (same clone as 84922-6-PBS)

  Chromatin was prepared from PC-12 cells starved overnight and treated with β-NGF (50 ng/ml) for 2 h. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 20 µg of cross-linked chromatin, 5 µg of JUNB (84922-6-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 84922-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84922-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84922-6-RR against Human JUNB were performed. The affinity constant is 0.213 nM.

JUNB Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR

Cat No. 84922-6-PBS

Clone No.242562G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR

Synonyms

242562G2, AP 1, AP-1

---

Product Information

84922-6-PBS targets JUNB in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA, ChIP-qPCR applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0752

  Product name: Recombinant human JUNB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC004250

  Sequence: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGA

• Full Name: jun B proto-oncogene
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 38 kDa, 42 kDa
• GenBank Accession Number: BC004250
• Gene Symbol: JUNB
• Gene ID (NCBI): 3726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P17275
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

JunB is one of the components of the Activator Protein-1 (AP-1) transcription complex that have been implicated in the control ofthe G0/G1 transtion in fibroblasts. AP-1 is a collection of dimers formed by members of the Jun-, Fos-, ATF- and Maf multigene families that bind to specific DNA regulatory elements called AP-1/12-O-tetradecanoylphorbol-13-acetate-responsive elements (TREs) and cAMP-responsive elements (CREs). JunB binds to the DNA sequence 5'-TGA[CG]TCA-3', and involves in the regulation of gene activity following the primary growth factor response. It also acts either as a tumor suppressor or as an oncogene depending on the cell and physiopathological context