KANK1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KANK1 Polyclonal antibody, PBS Only (29782-1-PBS)

• 

  WB analysis using 29782-1-AP (same clone as 29782-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29782-1-AP (KANK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29782-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 29782-1-AP (same clone as 29782-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 29782-1-AP (KANK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29782-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 29782-1-AP (same clone as 29782-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 29782-1-AP (KANK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29782-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 29782-1-AP (same clone as 29782-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using KANK1 antibody (29782-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29782-1-PBS in a different storage buffer formulation.

KANK1 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 29782-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

KN motif and ankyrin repeat domain-containing protein 1, Kidney ankyrin repeat-containing protein, KIAA0172, KANK, Ankyrin repeat domain-containing protein 15

---

Product Information

29782-1-PBS targets KANK1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31422

  Product name: Recombinant human KANK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 291-467 aa of NM_015158

  Sequence: ISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKE

• Full Name: KN motif and ankyrin repeat domains 1
• Calculated Molecular Weight: 147KD
• Observed Molecular Weight: 130-200 kDa
• GenBank Accession Number: NM_015158
• Gene Symbol: KANK1
• Gene ID (NCBI): 23189
• RRID: AB_3086160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14678
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KANK1 (KN motif and ankyrin repeat domain-containing protein 1) is involved in the control of cytoskeleton formation by regulating actin polymerization, inhibiting actin fiber formation and cell migration (PMID: 25961457). It inhibits RhoA activity, the formation of lamellipodia but not of filopodia (PMID: 25961457, PMID: 5961457).It also inhibits fibronectin-mediated cell spreading and regulates Rac signaling pathways (PMID: 25961457). Talin-KANK1 interaction controls the recruitment of cortical microtubule stabilizing complexes to focal adhesions (PMID: 27410476). KANK1 can be detected 130-200 kDa (PMID: 15823577, PMID: 33253712, PMID: 35805114).