Tested Applications
| Positive WB detected in | BGC-823 cells, NCI-H1299 cells, Raji cells, SH-SY5Y cells |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26590-1-AP targets KCC4/SLC12A7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24954 Product name: Recombinant human SLC12A7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 953-1004 aa of BC098390 Sequence: IHDRNTASHTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDL Predict reactive species |
| Full Name | solute carrier family 12 (potassium/chloride transporters), member 7 |
| Observed Molecular Weight | 119 kDa |
| GenBank Accession Number | BC098390 |
| Gene Symbol | KCC4/SLC12A7 |
| Gene ID (NCBI) | 10723 |
| RRID | AB_2918103 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y666 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KCC4, also named as Solute carrier family 12 member 7(SLC12A7), is a 1083 amino-acid protein, which belongs to the SLC12A transporter family. As a multi-pass membrane protein, the molecular weight of KCC4 is 119 kDa. KCC4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. Moreover, KCC4 may mediate K+ uptake into Deiters' cells in the cochlea and contribute to K+ recycling in the inner ear. KCC4 is important for the survival of cochlear outer and inner hair cells and the maintenance of the organ of Corti(Uniprot, GeneID:10723).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KCC4/SLC12A7 antibody 26590-1-AP | Download protocol |
| WB protocol for KCC4/SLC12A7 antibody 26590-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The KCC4/SLC12A7 Polyclonal antibody (Cat# 26590-1-AP) has 1 citation to date. It appears in Frontiers in Cell and Developmental Biology (2026), in a study investigating how SLC12A7 promotes malignant phenotypes in gastric cancer cells and its association with Ezrin-related PI3K/AKT signaling. The research falls within the fields of gastric cancer biology, ion transport, and intracellular signaling pathways.
| Species | Application | Title |
|---|---|---|
Front Cell Dev Biol SLC12A7 promotes malignant phenotypes of gastric cancer cells and is associated with Ezrin-related PI3K/AKT signaling. |
Reviews
What customers say
The single review (rated 1/5) describes a Western Blot experiment at 1:2000 dilution on MDA-MB-231 and A-431 cells. The reviewer confirmed the expected 120–130 kD bands through knockdown and overexpression controls, but observed an additional ~98 kD band attributed to possible degradation or non-specific binding. The antibody was stored at −20 °C as recommended. Overall, the specific band was validated, but the extra lower band raised concerns about specificity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bishwa Ranjan (Verified Customer) (08-03-2023) | In the Western blots there is an additional band below at 98kD which seems like a degradation or non-specific binding of the antibody. The bands showing at 120-130kD are accurate as we have seen in the lanes from knockdowns and overexpression of protein KCC4 For reference information about the lanes: 1. MDA KCC4 overexpression 2. MDA KCC4 knockdown sequence1 3. MDA KCC4 knockdown sequence2 4. MDA KCC4 knockdown sequence3 5. MDA scrambled control As you can see in lane 5 which is the control has expression of kCC4 at 120-130 range and for the knockdowns there is a decrease more significantly for 2nd sequence and for overexpression in lane 1 it is quite high so we believe the top band is the expected one and the bottom one is a result of degradation maybe so please advice on this matter. As for the antibody we received it in April 2023 and it is stored at -20 as mentioned.
 |
