KCC4/SLC12A7 Polyclonal antibody

KCC4/SLC12A7 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 26590-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

K Cl cotransporter 4, KCC4, KCC4/SLC12A7, SLC12A7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inBGC-823 cells, NCI-H1299 cells, Raji cells, SH-SY5Y cells
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26590-1-AP targets KCC4/SLC12A7 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24954

Product name: Recombinant human SLC12A7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 953-1004 aa of BC098390

Sequence: IHDRNTASHTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDL

Predict reactive species
Full Name solute carrier family 12 (potassium/chloride transporters), member 7
Observed Molecular Weight119 kDa
GenBank Accession NumberBC098390
Gene Symbol KCC4/SLC12A7
Gene ID (NCBI) 10723
RRIDAB_2918103
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y666
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KCC4, also named as Solute carrier family 12 member 7(SLC12A7), is a 1083 amino-acid protein, which belongs to the SLC12A transporter family. As a multi-pass membrane protein, the molecular weight of KCC4 is 119 kDa. KCC4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. Moreover, KCC4 may mediate K+ uptake into Deiters' cells in the cochlea and contribute to K+ recycling in the inner ear. KCC4 is important for the survival of cochlear outer and inner hair cells and the maintenance of the organ of Corti(Uniprot, GeneID:10723).

Protocols

Product Specific Protocols
IF protocol for KCC4/SLC12A7 antibody 26590-1-APDownload protocol
WB protocol for KCC4/SLC12A7 antibody 26590-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Bishwa Ranjan (Verified Customer) (08-03-2023)

In the Western blots there is an additional band below at 98kD which seems like a degradation or non-specific binding of the antibody. The bands showing at 120-130kD are accurate as we have seen in the lanes from knockdowns and overexpression of protein KCC4 For reference information about the lanes: 1. MDA KCC4 overexpression 2. MDA KCC4 knockdown sequence1 3. MDA KCC4 knockdown sequence2 4. MDA KCC4 knockdown sequence3 5. MDA scrambled control As you can see in lane 5 which is the control has expression of kCC4 at 120-130 range and for the knockdowns there is a decrease more significantly for 2nd sequence and for overexpression in lane 1 it is quite high so we believe the top band is the expected one and the bottom one is a result of degradation maybe so please advice on this matter. As for the antibody we received it in April 2023 and it is stored at -20 as mentioned.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: MDA-MB-231, A-431
KCC4/SLC12A7 Antibody Western Blot validation (1:2000 dilution) in MDA-MB-231, A-431 (Cat no:26590-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...