KCNA1 Polyclonal antibody

• 

  WB analysis using 18067-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18067-1-AP (KCNA1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

KCNA1 Polyclonal Antibody for WB, ELISA

Cat No. 18067-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

AEMK, EA1, HBK1, HUK1, KV1.1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18067-1-AP targets KCNA1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12699

  Product name: Recombinant human KCNA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC101733

  Sequence: MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESS

• Full Name: potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
• Calculated Molecular Weight: 495 aa, 56 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC101733
• Gene Symbol: KCNA1
• Gene ID (NCBI): 3736
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q09470
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Potassium voltage-gated channel subfamily A member 1 (KCNA1, also known as Kv1.1) is a voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney (PMID: 19903818; 8845167). KCNA1 expression was reduced in human cancers, and this decrease correlated with an increase in breast cancer aggressiveness (PMID: 23774215). Furthermore, Kv1.1 is expressed in the brain as a mature glycoprotein, which is reported to be 86 kDa (PMID: 16305740).