KCNA3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KCNA3 Polyclonal antibody (14079-1-AP)

• Featured Product
• KD/KO Validated

KCNA3 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 14079-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

Kv1.3, HGK5, HLK3, HPCN3, HUKIII

• 

  WB analysis of A549 using 14079-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 14079-1-AP (Kv1.3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 14079-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 14079-1-AP (Kv1.3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 14079-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 14079-1-AP (Kv1.3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Rat brain using 14079-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Rat brain tissue using Kv1.3 antibody (14079-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KCNA3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse thymus tissue
• Positive IF-P detected in: Rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14079-1-AP targets KCNA3 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5204

  Product name: Recombinant human KCNA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-226 aa of BC035059

  Sequence: DERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEY

• Full Name: potassium voltage-gated channel, shaker-related subfamily, member 3
• Calculated Molecular Weight: 575 aa, 64 kDa
• Observed Molecular Weight: 52 kDa, 75 kDa
• GenBank Accession Number: BC035059
• Gene Symbol: KCNA3
• Gene ID (NCBI): 3738
• RRID: AB_2878011
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22001
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kv1.3 ( also known as KCNA3, MK3, HGK5, HLK3, PCN3, HPCN3) contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T cell proliferation and activation. Kv1.3 channels are expressed in in various tissues and cell types including brain, vascular smooth muscle cells and leucocytes. Malfunction of Kv1.3 can alter the immune response, elicit neurotoxic effects or impact on cancer growth(PMID: 24305723; 24133455). 14079-1-AP can detect two isoforms of Kv1.3 other than the canonical channel (60 KDa) : A longer isoform (70 KDa) and a truncated isoform (43 KDa).

Publications

What published studies show

The KCNA3 (Kv1.3) Polyclonal antibody (Cat# 14079-1-AP) has 12 total citations. These appear in journals including Cell Mol Immunol, Cell Death Discov, Int J Biol Macromol, J Ethnopharmacol, Transl Res, Int Immunopharmacol, Front Pharmacol, J Mol Med, FASEB J, Int J Clin Exp Med, Eur J Med Chem, and Biomolecules. Research fields span ion channel biology, inflammation, asthma, NASH/steatohepatitis, ulcerative colitis, viral entry, hypertension, and drug discovery.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Mol Immunol; NLRP3-dependent pyroptosis is required for HIV-1 gp120-induced neuropathology.; Authors - Xiaolong He ; KD Validated
mouse	WB,IF	Cell Death Discov; Therapeutic potential of voltage-dependent potassium channel subtype 1.3 blockade in alleviating macrophage-related renal inflammation and fibrogenesis; Authors - Sha-Sha Li
rat	IF	Int J Biol Macromol; Discovery of therapeutic promising natural products to target Kv1.3 channel, a transmembrane protein regulating immune disorders, through multidimensional virtual screening, molecular dynamics simulations and biological validation; Authors - Shanshan Zhang
mouse	WB,IF	J Ethnopharmacol; Processed Buthus martensii Karsch scorpions ameliorate diet-induced NASH in mice by attenuating Kv1.3-mediated macrophage activation; Authors - Erjin Xu
human,mouse	WB,IF	Transl Res; Kv1.3 expression on CD4 (+) T cells promotes interleukin-17A-associated airway inflammation and airway remodeling in asthma; Authors - Bingqing Sun
mouse	WB,IF	Int Immunopharmacol; Clarithromycin attenuates airway epithelial-mesenchymal transition in ovalbumin-induced asthmatic mice through modulation of Kv1.3 channels and PI3K/Akt signaling; Authors - Bingqing Sun