KCNA3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of U-937 using 85049-4-RR (same clone as 85049-4-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 85049-4-RR (KCNA3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85049-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85049-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85049-4-RR against Human KCNA3 were performed. The affinity constant is below 1 pM.

KCNA3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85049-4-PBS

Clone No.242588H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Kv1.3, HUKIII, HPCN3, HLK3, HGK5

---

Product Information

85049-4-PBS targets KCNA3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5204

  Product name: Recombinant human KCNA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-226 aa of BC035059

  Sequence: DERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDHLLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEY

• Full Name: potassium voltage-gated channel, shaker-related subfamily, member 3
• Calculated Molecular Weight: 575 aa, 64 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC035059
• Gene Symbol: KCNA3
• Gene ID (NCBI): 3738
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22001
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Kv1.3 ( also known as KCNA3, MK3, HGK5, HLK3, PCN3, HPCN3) contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, which allows nerve cells to repolarize following an action potential efficiently. It plays an essential role in T cell proliferation and activation. Kv1.3 channels are expressed in various tissues and cell types including the brain, vascular smooth muscle cells, and leucocytes. Malfunction of Kv1.3 can alter the immune response, elicit neurotoxic effects or impact on cancer growth(PMID: 24305723; 24133455).