Kv4.1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Kv4.1 Polyclonal antibody (13768-1-AP)

Kv4.1 Polyclonal Antibody for WB, ELISA

Cat No. 13768-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

KCND1, Kv4.1

• 

  WB analysis of human heart using 13768-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 13768-1-AP (Kv4.1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 13768-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13768-1-AP (Kv4.1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Kv4.1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human heart tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13768-1-AP targets Kv4.1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4751

  Product name: Recombinant human KCND1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 410-647 aa of BC045659

  Sequence: NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL

• Full Name: potassium voltage-gated channel, Shal-related subfamily, member 1
• Calculated Molecular Weight: 647 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC045659
• Gene Symbol: Kv4.1
• Gene ID (NCBI): 3750
• RRID: AB_2265342
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NSA2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Kv4.1 Polyclonal antibody (Cat# 13768-1-AP) has 1 citation. It was cited in Molecular Neurobiology (2023) in a study investigating how environmental enrichment improves recognition memory in adult mice following social isolation via downregulation of Kv4.2 potassium channels. The research field is neuroscience, specifically memory and ion channel biology. The antibody was used for Western blot in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Neurobiol; Environmental Enrichment Improves the Recognition Memory in Adult Mice Following Social Isolation via Downregulation of Kv4.2 Potassium Channels; Authors - Qing Shang