KCNH2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KCNH2 Polyclonal antibody (30853-1-AP)

• 

  WB analysis using 30853-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30853-1-AP (KCNH2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

KCNH2 Polyclonal Antibody for WB, ELISA

Cat No. 30853-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Eag homolog, Eag related protein 1, Eag-related protein 1, ERG, ERG 1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, MDA-MB-231 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30853-1-AP targets KCNH2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34230

  Product name: Recombinant human KCNH2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 880-1159 aa of NM_000238

  Sequence: GFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSSPRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTPSLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS

• Full Name: potassium voltage-gated channel, subfamily H (eag-related), member 2
• Calculated Molecular Weight: 127 kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: NM_000238
• Gene Symbol: KCNH2
• Gene ID (NCBI): 3757
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q12809
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Voltage-gated inwardly rectifying potassium channel KCNH2 (also known as ERG1, Kv11.1, and HERG) is a key member of the voltage-gated potassium (Kv) channel family (PMID: 16382104). Growing evidence has indicated that the association between KCNH2 and hypoglycemia, an adverse effect induced by KCNH2 blockers, implies a potential regulatory role of this channel in the maintenance of blood glucose homeostasis (PMID: 21224236; 31863282). Mutations in the KCNH2 gene are recognized as one of the etiological factors of congenital long QT syndrome (LQTS), a rare syndrome that carries an increased risk of cardiac arrhythmias, including the polymorphic ventricular tachycardia termed torsades de pointes (TdP) (PMID: 17143043; 16554806).