Published Applications
| WB | See 1 publications below |
Product Information
20192-1-AP targets KCNIP2 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14111 Product name: Recombinant human KCNIP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC034685 Sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCH Predict reactive species |
| Full Name | Kv channel interacting protein 2 |
| Calculated Molecular Weight | 270 aa, 31 kDa |
| Observed Molecular Weight | 29-31 kDa |
| GenBank Accession Number | BC034685 |
| Gene Symbol | KCNIP2 |
| Gene ID (NCBI) | 30819 |
| RRID | AB_2878655 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NS61 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KCNIP2 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.This antibody can recognize 31 kDa and 29 kDa isoforms.
