KCNIP2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• KCNIP2 Recombinant monoclonal antibody (86696-1-RR)

• 

  WB analysis using 86696-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86696-1-RR (KCNIP2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86696-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86696-1-RR against Human KCNIP2 were performed. The affinity constant is 3.84 nM.

KCNIP2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86696-1-RR

Clone No.251560C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

A-type potassium channel modulatory protein 2, Cardiac voltage-gated potassium channel modulatory subunit, KChIP2, Kv channel-interacting protein 2, Potassium channel-interacting protein 2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86696-1-RR targets KCNIP2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14111

  Product name: Recombinant human KCNIP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC034685

  Sequence: MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCH

• Full Name: Kv channel interacting protein 2
• Calculated Molecular Weight: 270 aa, 31 kDa
• Observed Molecular Weight: 31-35 kDa
• GenBank Accession Number: BC034685
• Gene Symbol: KCNIP2
• Gene ID (NCBI): 30819
• RRID: AB_3745060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NS61
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KCNIP2 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.