KCNIP4 Monoclonal antibody

• 

  WB analysis of pig brain using 60133-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 60133-1-Ig (KCNIP4 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 60133-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 60133-1-Ig (KCNIP4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 60133-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 60133-1-Ig (KCNIP4 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 60133-1-Ig

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 60133-1-Ig (KCNIP4 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 60133-1-Ig

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 60133-1-Ig (KCNIP4 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 60133-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using KCNIP4 antibody (60133-1-Ig, Clone: 5B1D12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of mouse brain using 60133-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using KCNIP4 antibody (60133-1-Ig, Clone: 5B1D12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

KCNIP4 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60133-1-Ig

Clone No.5B1D12

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

A-type potassium channel modulatory protein 4, CALP, Calsenilin like protein, Calsenilin-like protein, KCHIP4

---

Tested Applications

• Positive WB detected in: pig brain tissue, human brain tissue, rat brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 2 publications below

Product Information

60133-1-Ig targets KCNIP4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4863

  Product name: Recombinant human KCNIP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC032520

  Sequence: MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI

• Full Name: Kv channel interacting protein 4
• Calculated Molecular Weight: 250 aa, 28 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC032520
• Gene Symbol: KCNIP4
• Gene ID (NCBI): 80333
• RRID: AB_2130271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6PIL6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KCNIP4 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	iScience; Single-nucleus RNA sequencing-based construction of a hippocampal neuron atlas in mice with epileptic cognitive impairment; Authors - Jia-Qi Ma
mouse,human	WB,IF	bioRxiv; Molecular Signatures of Resilience to Alzheimer's Disease in Neocortical Layer 4 Neurons; Authors - S Akila Parvathy Dharshini