KCNJ18 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCNJ18 Polyclonal antibody, PBS Only (30911-1-PBS)

• 

  WB analysis of mouse skin using 30911-1-AP (same clone as 30911-1-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 30911-1-AP (KCNJ18 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30911-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skin using 30911-1-AP (same clone as 30911-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skin tissue using KCNJ18 antibody (30911-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30911-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skin using 30911-1-AP (same clone as 30911-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skin tissue using KCNJ18 antibody (30911-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30911-1-PBS in a different storage buffer formulation.

KCNJ18 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 30911-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

---

Product Information

30911-1-PBS targets KCNJ18 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34177

  Product name: Recombinant human KCNJ18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 353-433 aa of NM_001194958

  Sequence: STPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRGSEI

• Full Name: similar to hkir2.2x
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_001194958
• Gene Symbol: KCNJ18
• Gene ID (NCBI): 100134444
• RRID: AB_3669782
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: B7U540
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mutations in KCNJ18 gene encoding an inwardly rectifying potassium channel (Kir2.6) cause thyrotoxic periodic paralysis (TPP) and sporadic, that is, non-familial cases of HypoPP. Mutant Kir2.6 proteins form a heterotetrameric Kir channel complex with Kir2.1 and thereby reduce cell surface expression of the complex. (PMID: 25882930)