KCNJ18 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84203-5-RR (same clone as 84203-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84203-5-RR (KCNJ18 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84203-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 84203-5-RR (same clone as 84203-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 84203-5-RR (KCNJ18 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84203-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 84203-5-RR (same clone as 84203-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 84203-5-RR (KCNJ18 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84203-5-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skin using 84203-5-RR (same clone as 84203-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skin tissue using KCNJ18 antibody (84203-5-RR, Clone: 241381A2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84203-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84203-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84203-5-RR against Human KCNJ18 were performed. The affinity constant is below 3.06 nM.

KCNJ18 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84203-5-PBS

Clone No.241381A2

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

TTPP2, KIR2.6, Inward rectifier potassium channel 18, 241381A2

---

Product Information

84203-5-PBS targets KCNJ18 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34177

  Product name: Recombinant human KCNJ18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 353-433 aa of NM_001194958

  Sequence: STPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRGSEI

• Full Name: similar to hkir2.2x
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_001194958
• Gene Symbol: KCNJ18
• Gene ID (NCBI): 100134444
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: B7U540
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mutations in KCNJ18 gene encoding an inwardly rectifying potassium channel (Kir2.6) cause thyrotoxic periodic paralysis (TPP) and sporadic, that is, non-familial cases of HypoPP. Mutant Kir2.6 proteins form a heterotetrameric Kir channel complex with Kir2.1 and thereby reduce cell surface expression of the complex. (PMID: 25882930)