Product Information
29762-1-PBS targets KCNK12 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31561 Product name: Recombinant human KCNK12 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 302-430 aa of NM_022055 Sequence: IKQVLNWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGADPAARDSDAEGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMNNRLAETSASR Predict reactive species |
| Full Name | potassium channel, subfamily K, member 12 |
| Calculated Molecular Weight | 47KD |
| Observed Molecular Weight | 49 kDa |
| GenBank Accession Number | NM_022055 |
| Gene Symbol | KCNK12 |
| Gene ID (NCBI) | 56660 |
| RRID | AB_3086156 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HB15 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Potassium channel, subfamily K, member 12, also known as KCNK12, is a potassium channel containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. The calculated MW is 49 kDa, 29762-1-AP can detect a band around 49 kDa.
