KCNK4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KCNK4 Polyclonal antibody (27113-1-AP)

KCNK4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27113-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

K2p4.1, KCNK4, TRAAK, TRAAK1, Two pore K(+) channel KT4.1

• 

  WB analysis using 27113-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27113-1-AP (KCNK4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse eye using 27113-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 27113-1-AP (KCNK4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 27113-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27113-1-AP (KCNK4 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 27113-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27113-1-AP (KCNK4 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KCNK4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse eye tissue, rat eye tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27113-1-AP targets KCNK4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25931

  Product name: Recombinant human KCNK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 261-393 aa of BC033577

  Sequence: SRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV

• Full Name: potassium channel, subfamily K, member 4
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC033577
• Gene Symbol: KCNK4
• Gene ID (NCBI): 50801
• RRID: AB_2880761
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYG8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

KCNK4 Polyclonal antibody (27113-1-AP)

• Antibody name: KCNK4 Polyclonal antibody
• Catalog number: 27113-1-AP
• Total citation count: 1
• Journal: Functional & Integrative Genomics (Funct Integr Genomics)
• Research field: Oncology — specifically, the citation investigates lncRNA SLC25A21-AS1's role in enhancing chemosensitivity and inhibiting ovarian cancer progression by upregulating KCNK4 expression (validated by Western blot in human samples).

This single published citation situates the antibody within the ovarian cancer/chemoresistance research field.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Funct Integr Genomics; LncRNA SLC25A21-AS1 increases the chemosensitivity and inhibits the progression of ovarian cancer by upregulating the expression of KCNK4; Authors - Ke Huang