KCNK9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KCNK9 Polyclonal antibody (18033-1-AP)

KCNK9 Polyclonal Antibody for WB, ELISA

Cat No. 18033-1-AP Copied!

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Acid-sensitive potassium channel protein TASK-3, K2p9.1, KT3.2, TASK 3, TASK3

• 

  WB analysis using 18033-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18033-1-AP (KCNK9 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KCNK9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18033-1-AP targets KCNK9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12603

  Product name: Recombinant human KCNK9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 246-374 aa of BC075079

  Sequence: FLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV

• Full Name: potassium channel, subfamily K, member 9
• Calculated Molecular Weight: 374 aa, 42 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC075079
• Gene Symbol: KCNK9
• Gene ID (NCBI): 51305
• RRID: AB_3741942
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPC2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

4.0 out of 5

2 verified customer reviews

What customers say

This product has received 2 reviews, both rated 4 out of 5 stars. One review covers Western Blot at a 1:2000 dilution, and the other covers Immunofluorescence at a 1:500 dilution, both performed on Primary Embryonic Cortical Neurons (DIV10). No written comments were provided, but the accompanying images demonstrate clear and specific signal for both applications. Overall, the reviews suggest reliable performance for detecting the target in neuronal cell preparations.

Automatically generated from the 2 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Connor (Verified Customer) (08-24-2018)

• Applications: Western Blot,
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Primary Embryonic Cortical Neurons DIV10

KCNK9 Antibody Western Blot, validation (1:2000 dilution) in Primary Embryonic Cortical Neurons DIV10 (Cat no:18033-1-AP)

Connor (Verified Customer) (08-24-2018)

• Applications: Immunofluorescence,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Primary Embryonic Cortical Neurons DIV10

KCNK9 Antibody Immunofluorescence, validation (1:500 dilution) in Primary Embryonic Cortical Neurons DIV10 (Cat no:18033-1-AP)