Tested Applications
| Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18033-1-AP targets KCNK9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12603 Product name: Recombinant human KCNK9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 246-374 aa of BC075079 Sequence: FLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV Predict reactive species |
| Full Name | potassium channel, subfamily K, member 9 |
| Calculated Molecular Weight | 374 aa, 42 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC075079 |
| Gene Symbol | KCNK9 |
| Gene ID (NCBI) | 51305 |
| RRID | AB_3741942 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NPC2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KCNK9 antibody 18033-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Connor (Verified Customer) (08-24-2018) |
![]() |
FH Connor (Verified Customer) (08-24-2018) |
![]() |



