KCNK9 Polyclonal antibody

• 

  WB analysis using 18033-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18033-1-AP (KCNK9 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

KCNK9 Polyclonal Antibody for WB, ELISA

Cat No. 18033-1-AP

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Acid-sensitive potassium channel protein TASK-3, K2p9.1, KT3.2, TASK 3, TASK3

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18033-1-AP targets KCNK9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12603

  Product name: Recombinant human KCNK9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 246-374 aa of BC075079

  Sequence: FLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV

• Full Name: potassium channel, subfamily K, member 9
• Calculated Molecular Weight: 374 aa, 42 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC075079
• Gene Symbol: KCNK9
• Gene ID (NCBI): 51305
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPC2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Connor (Verified Customer) (08-24-2018)

• Applications: Western Blot,
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Primary Embryonic Cortical Neurons DIV10

KCNK9 Antibody Western Blot, validation (1:2000 dilution) in Primary Embryonic Cortical Neurons DIV10 (Cat no:18033-1-AP)

FH

Connor (Verified Customer) (08-24-2018)

• Applications: Immunofluorescence,
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Primary Embryonic Cortical Neurons DIV10

KCNK9 Antibody Immunofluorescence, validation (1:500 dilution) in Primary Embryonic Cortical Neurons DIV10 (Cat no:18033-1-AP)