KCNS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCNS2 Polyclonal antibody, PBS Only (13443-1-PBS)

• 

  WB analysis of Y79 using 13443-1-AP (same clone as 13443-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 13443-1-AP (KCNS2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13443-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 13443-1-AP (same clone as 13443-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13443-1-AP (KCNS2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13443-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 13443-1-AP (same clone as 13443-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13443-1-AP (KCNS2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13443-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 13443-1-AP (same clone as 13443-1-PBS)

  IP result of anti-KCNS2 (IP:13443-1-AP, 4ug; Detection:13443-1-AP 1:300) with HepG2 cells lysate 3400ug. This data was developed using the same antibody clone with 13443-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human eye using 13443-1-AP (same clone as 13443-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human eye using 13443-1-AP (KCNS2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13443-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human eye using 13443-1-AP (same clone as 13443-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human eye using 13443-1-AP (KCNS2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 13443-1-PBS in a different storage buffer formulation.

KCNS2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13443-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

13443-1-PBS targets KCNS2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4271

  Product name: Recombinant human KCNS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC027932

  Sequence: MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSR

• Full Name: potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2
• Calculated Molecular Weight: 477 aa, 54 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC027932
• Gene Symbol: KCNS2
• Gene ID (NCBI): 3788
• RRID: AB_2249596
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULS6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.