KCNS3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCNS3 Polyclonal antibody, PBS Only (10092-1-PBS)

• 

  WB analysis of HeLa using 10092-1-AP (same clone as 10092-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10092-1-AP (KCNS3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10092-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 10092-1-AP (same clone as 10092-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 10092-1-AP (KCNS3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10092-1-PBS in a different storage buffer formulation.

KCNS3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10092-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

10092-1-PBS targets KCNS3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0137

  Product name: Recombinant human KCNS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-298 aa of BC004148

  Sequence: FHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNRYQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAYCLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGLEIACIAWFTGELAVRLAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIF

• Full Name: potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC004148
• Gene Symbol: KCNS3
• Gene ID (NCBI): 3790
• RRID: AB_3085364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQ31
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KCNS3, also name as Kv9.3, belongs to S subfamily of potassium voltage-gated channel. It is highly expressed in pulmonary artery myocytes, placenta, and parvalbumin-containing GABA neurons in brain cortex.Its main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials.