KCTD14 Polyclonal antibody

KCTD14 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 21111-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

BTB/POZ domain-containing protein KCTD14

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skeletal muscle tissue, mouse brain tissue, mouse small intestine tissue
Positive IHC detected inhuman stomach cancer tissue, human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21111-1-AP targets KCTD14 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14265

Product name: Recombinant human KCTD14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-225 aa of BC001929

Sequence: MSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKASTDAEGRFFIDRPSTYFRPILDYLRTGQVPTQHIPEVYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLLQVPGYSENLELMVRLARAEAITARKSSVLVCLVETEEQDAYYSEVLCFLQDKKMFKSVVKFGPWKAVLDNSDLMHCLEMDIKAQGYKVFSKFYLTYPTKRNEFHFNIYSFTFTWW

Predict reactive species
Full Name potassium channel tetramerisation domain containing 14
Calculated Molecular Weight 225 aa, 26 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC001929
Gene Symbol KCTD14
Gene ID (NCBI) 65987
RRIDAB_10733343
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BQ13
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KCTD14, or potassium channel tetramerization domain containing 14, is a member of the KCTD family of proteins. This family consists of 25 members in humans, many of which are only partially characterized . KCTD14, like other members of the KCTD family, contains a conserved domain known as the BTB (Broad complex, Tramtrak, and Bric-a-brac)/POZ (poxvirus zinc finger) domain, which is crucial for protein oligomerization and establishing protein-protein interactions. KCTD14 has been implicated in various biological functions, and recent research suggests a potential role in cancer. Although not as extensively studied as some other KCTD members, KCTD14 has been noted in database analyses to potentially play a protumor role in ovarian cancer. Specifically, the COSMIC database reports a copy number variation (CNV) gain in 4.5% of ovarian cancers, and the GENT2 database indicates a fold change (FC) of 1.5 in expression, with a p-value less than 0.001, suggesting a possible association with ovarian cancer.

Protocols

Product Specific Protocols
WB protocol for KCTD14 antibody 21111-1-APDownload protocol
IHC protocol for KCTD14 antibody 21111-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...