KCTD19 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KCTD19 Polyclonal antibody, PBS Only (33194-1-PBS)

• 

  WB analysis using 33194-1-AP (same clone as 33194-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33194-1-AP (KCTD19 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33194-1-PBS in a different storage buffer formulation.

KCTD19 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33194-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

BTB/POZ domain-containing protein KCTD19, Potassium channel tetramerization domain-containing protein 19

---

Product Information

33194-1-PBS targets KCTD19 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36660

  Product name: Recombinant human KCTD19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of NM_001100915.3

  Sequence: MEESGMAHESAEDLFHFNVGGWHFSVPRSKLSQFPDSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNLLYEQALGLQLMPLLQTLDNLKEGKHHLRVRPADLPVAERASLNYWRTWKCISKPSEFPIKSPAFT

• Full Name: potassium channel tetramerisation domain containing 19
• Calculated Molecular Weight: 105 kDa，926aa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: NM_001100915.3
• Gene Symbol: KCTD19
• Gene ID (NCBI): 146212
• RRID: AB_3742889
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q17RG1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.