KCTD20 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KCTD20 Polyclonal antibody (32728-1-AP)

KCTD20 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 32728-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

BTB/POZ domain-containing protein KCTD20, C6orf69, Potassium channel tetramerization domain containing 20

• 

  IHC staining of mouse kidney using 32728-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32728-1-AP (KCTD20 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 32728-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 32728-1-AP (KCTD20 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U-251 using 32728-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using KCTD20 antibody (32728-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32728-1-AP targets KCTD20 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36947

  Product name: Recombinant human KCTD20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of NM_173562.4

  Sequence: MNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYASQPANLQFPHIMPLAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPD

• Full Name: potassium channel tetramerisation domain containing 20
• Calculated Molecular Weight: 47kDa，419aa
• GenBank Accession Number: NM_173562.4
• Gene Symbol: KCTD20
• Gene ID (NCBI): 222658
• RRID: AB_3742726
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z5Y7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KCTD20 encodes a BTB/POZ domain-containing protein that is predicted to enable identical protein binding and participate in positive regulation of phosphorylation. The protein belongs to the KCTD family and contains a BTB/POZ domain architecture, placing it among proteins commonly associated with protein-protein interactions. It is found in the cytoplasm and at the membrane, with additional localization reported in the endoplasmic reticulum and nuclear speck.