KDM1B Monoclonal antibody

• 

  WB analysis using 67886-1-Ig

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 67886-1-Ig (KDM1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 67886-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67886-1-Ig (KDM1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of C6 using 67886-1-Ig

  C6 cells were subjected to SDS PAGE followed by western blot with 67886-1-Ig (KDM1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 67886-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67886-1-Ig (KDM1B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of SW 1990 using 67886-1-Ig

  1X10^6 SW 1990 cells were intracellularly stained with 0.4 ug Anti-HUMAN KDM1B (67886-1-Ig, Clone:1E1A3) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

KDM1B Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 67886-1-Ig

Clone No.1E1A3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

Synonyms

AOF1, LSD2, C6orf193, 1E1A3

---

Tested Applications

• Positive WB detected in: HCT 116 cells, K-562 cells, C6 cells, NIH/3T3 cells, A549 cells, HeLa cells, Jurkat cells
• Positive FC (Intra) detected in: SW 1990 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67886-1-Ig targets KDM1B in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30672

  Product name: Recombinant human KDM1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 666-822 aa of NM_001364614

  Sequence: FPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF

• Full Name: amine oxidase (flavin containing) domain 1
• Calculated Molecular Weight: 92 kDa
• Observed Molecular Weight: 92 kDa
• GenBank Accession Number: NM_001364614
• Gene Symbol: KDM1B
• Gene ID (NCBI): 221656
• RRID: AB_2918643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NB78
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.