KDM3B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KDM3B Polyclonal antibody, PBS Only (19915-1-PBS)

• 

  WB analysis using 19915-1-AP (same clone as 19915-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19915-1-AP (KDM3B antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19915-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 19915-1-AP (same clone as 19915-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 19915-1-AP (KDM3B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19915-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 19915-1-AP (same clone as 19915-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using KDM3B antibody (19915-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 19915-1-PBS in a different storage buffer formulation.

KDM3B Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 19915-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

19915-1-PBS targets KDM3B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13795

  Product name: Recombinant human KDM3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1127-1382 aa of BC001202

  Sequence: SRQNKSVLRPAVTNGMSQLPSINPSASSGNETTFSGGGGPAPVTTPEPDHVPKADSTDIRSEEPLKTDSSASNSNSELKAIRPPCPDTAPPSSALHWLADLATQKAKEETKEAGSLRSVLNKESHSPFGLDSFNSTAKVSPLTPKLFNSLLLGPTASNNKTEGSSLRDLLHSGPGKLPQTPLDTGIPFPPVFSTSSAGVKSKASLPNFLDHIIASVVENKKTSDASKRACNLTDTQKEVKEMVMGLNVLDPHTSHS

• Full Name: lysine (K)-specific demethylase 3B
• Calculated Molecular Weight: 1761 aa, 192 kDa
• Observed Molecular Weight: 192 kDa, 85 kDa
• GenBank Accession Number: BC001202
• Gene Symbol: KDM3B
• Gene ID (NCBI): 51780
• RRID: AB_10693529
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7LBC6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.