KDM4D Polyclonal antibody

• 

  WB analysis of PC-3 using 22591-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 22591-1-AP (KDM4D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 22591-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 22591-1-AP (KDM4D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 22591-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 22591-1-AP (KDM4D Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thymus using 22591-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 22591-1-AP (KDM4D Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thymus using 22591-1-AP

  Immunohistochemical analysis of paraffin-embedded human thymus tissue slide using 22591-1-AP (KDM4D Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

KDM4D Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22591-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IP, ChIP, ELISA

Synonyms

JHDM3D, JMJD2D, KDM4D, lysine (K) demethylase 4D, Lysine specific demethylase 4D

---

Tested Applications

• Positive WB detected in: PC-3 cells
• Positive IHC detected in: human thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below
• IP: See 1 publications below
• ChIP: See 1 publications below

Product Information

22591-1-AP targets KDM4D in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18436

  Product name: Recombinant human KDM4D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 332-523 aa of BC122858

  Sequence: RYDLWKRGQDRAVVDHMEPRVPASQELSTQKEVQLPRRAALGLRQLPSHWARHSPWPMAARSGTRCHTLVCSSLPRQSAVSGTATQPRAAAVHSSKKPSSTPSSTPGPSAQIIHPSNGRRGRGRPPQKLRAQELTLQTPAKRPLLAGTTCTASGPEPEPLPEDGALMDKPVPLSPGLQHPVKASGCSWAPVP

• Full Name: lysine (K)-specific demethylase 4D
• Calculated Molecular Weight: 523 aa, 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC122858
• Gene Symbol: KDM4D
• Gene ID (NCBI): 55693
• RRID: AB_2879130
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6B0I6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IP	JHEP Rep; JMJD2D stabilises and cooperates with HBx protein to promote HBV transcription and replication; Authors - Xu Kong ; KD Validated
rat	ChIP	Front Cell Dev Biol; A KDM4-DBC1-SIRT1 Axis Contributes to TGF-b Induced Mesenchymal Transition of Intestinal Epithelial Cells; Authors - Baoyu Chen
human	IHC	Discov Oncol; Histone demethylase JMJD2D emerges as a novel prognostic biomarker and exhibits correlation with immune infiltration in lung adenocarcinoma; Authors - Bona Liu