KDM5D Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KDM5D Polyclonal antibody (22739-1-AP)

KDM5D Polyclonal Antibody for WB, ELISA

Cat No. 22739-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

H Y, Histocompatibility Y antigen, Histone demethylase JARID1D, HY, HYA, JARID1D, KDM5D, KIAA0234, lysine (K) demethylase 5D, Lysine specific demethylase 5D, Protein SmcY, SMCY

• 

  WB analysis using 22739-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22739-1-AP (KDM5D antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KDM5D in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: TF-1 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22739-1-AP targets KDM5D in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18690

  Product name: Recombinant human KDM5D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1375-1482 aa of BC146767

  Sequence: SRTRSRALERRRRRQKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDHSPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL

• Full Name: lysine (K)-specific demethylase 5D
• Calculated Molecular Weight: 1482 aa, 167 kDa
• Observed Molecular Weight: 70 kDa, 175 kDa
• GenBank Accession Number: BC146767
• Gene Symbol: KDM5D
• Gene ID (NCBI): 8284
• RRID: AB_2879160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BY66
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The KDM5D Polyclonal antibody (Cat# 22739-1-AP) has 4 citations published in Nature Metabolism, International Journal of Biological Sciences, Cell Signaling, and Translational Andrology and Urology. The research fields span epigenetic regulation of gene expression, tumorigenesis, chemoresistance mechanisms, colorectal cancer, and prostate cancer treatment response prediction.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Metab; Myc-mediated SDHA acetylation triggers epigenetic regulation of gene expression and tumorigenesis.; Authors - Shi-Ting Li
human	WB	Int J Biol Sci; KDM5B demethylates H3K4 to recruit XRCC1 and promote chemoresistance.; Authors - Wenxia Xu
		Cell Signal; KDM5D epigenetically represses FERD3L to inhibit tumor growth in male colorectal cancer.; Authors - Jianwei Yu
human	IHC	Transl Androl Urol; KDM5D predicts response to docetaxel chemotherapy in metastatic castration resistant prostate cancer patients.; Authors - Georg Schäfer