Tested Applications
| Positive WB detected in | TF-1 cells, Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22739-1-AP targets KDM5D in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18690 Product name: Recombinant human KDM5D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1375-1482 aa of BC146767 Sequence: SRTRSRALERRRRRQKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDHSPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL Predict reactive species |
| Full Name | lysine (K)-specific demethylase 5D |
| Calculated Molecular Weight | 1482 aa, 167 kDa |
| Observed Molecular Weight | 70 kDa, 175 kDa |
| GenBank Accession Number | BC146767 |
| Gene Symbol | KDM5D |
| Gene ID (NCBI) | 8284 |
| RRID | AB_2879160 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BY66 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for KDM5D antibody 22739-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Transl Androl Urol KDM5D predicts response to docetaxel chemotherapy in metastatic castration resistant prostate cancer patients. | ||
Nat Metab Myc-mediated SDHA acetylation triggers epigenetic regulation of gene expression and tumorigenesis. | ||
Cell Signal KDM5D epigenetically represses FERD3L to inhibit tumor growth in male colorectal cancer. |

