KERA Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of rat eye using 83272-1-RR (same clone as 83272-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat eye tissue using KERA antibody (83272-1-RR, Clone: 230399B11 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83272-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U251 using 83272-1-RR (same clone as 83272-1-PBS)

  1x10^6 U251 were intracellularly stained with 0.2 ug KERA Recombinant Antibody (83272-1-RR, Clone:230399B11) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.2 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83272-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83272-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83272-1-RR against Human KERA were performed. The affinity constant is below 1 pM.

KERA Uni-rAb^® Recombinant Antibody for IF-P, FC (Intra), Indirect ELISA

Cat No. 83272-1-PBS

Clone No.230399B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P, FC (Intra), Indirect ELISA

Synonyms

Keratocan, 230399B11, CNA2, KTN, SLRR2B

---

Product Information

83272-1-PBS targets KERA in IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34171

  Product name: Recombinant human KERA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 210-320 aa of BC032667

  Sequence: RLPANTMQLFLDNNSIEGIPENYFNVIPKVAFLRLNHNKLSDEGLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHLHLDHNKIKSVNVSVICPSPSMLPAERDSFSYGP

• Full Name: keratocan
• Calculated Molecular Weight: 352 aa, 41 kDa
• GenBank Accession Number: BC032667
• Gene Symbol: KERA
• Gene ID (NCBI): 11081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O60938
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Keratocan and Lumican are the predominant class II SLRPs(Small leucine-rich proteoglycans) in the corneal stroma. While not totally corneal-specific together these SLRPs are excellent biomarkers for the tissue. Mutant mice deficient for keratocan expression have transparent but thin corneal stromas with a mild increase in collagen fibril diameter with no further abnormalities.In humans, mutations in the keratocan gene are associated with a flattened cornea in a rare condition known as cornea plana. The relative specificity of keratocan to corneal keratocytes has been useful for tissue-specific targeting for genetic manipulation of the corneal stroma.(PMID: 32663498)