KIAA0196 Polyclonal antibody

• 

  WB analysis using 32028-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32028-1-AP (KIAA0196 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

KIAA0196 Polyclonal Antibody for WB, ELISA

Cat No. 32028-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

WASHC5, WASH complex subunit strumpellin, WASH complex subunit 5, Strumpellin

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32028-1-AP targets KIAA0196 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36916

  Product name: Recombinant human KIAA0196 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 950-1159 aa of NM_014846.3

  Sequence: KVGQMQILRQQIANELNYSCRFDSKHLAAALENLNKALLADIEAHYQDPSLPYPKEDNTLLYEITAYLEAAGIHNPLNKIYITTKRLPYFPIVNFLFLIAQLPKLQYNKNLGMVCRKPTDPVDWPPLVLGLLTLLKQFHSRYTEQFLALIGQFICSTVEQCTSQKIPEIPADVVGALLFLEDYVRYTKLPRRVAEAHVPNFIFDEFRTVL

• Full Name: KIAA0196
• Calculated Molecular Weight: 134kDa，1159aa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: NM_014846.3
• Gene Symbol: KIAA0196
• Gene ID (NCBI): 9897
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q12768
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KIAA0196 is a core component of the WASH complex, an actin-regulating complex involved in intracellular trafficking, mitochondrial metabolism, and myelination. It plays a crucial role in maintaining the structural integrity of myofibrils and regulating cardiac function. Recent studies have identified KIAA0196 as a susceptibility gene for abnormal cardiac development. Mutations or reduced expression of KIAA0196 can lead to cardiac defects, such as enlarged hearts and myocardial contractile dysfunction (PMID: 32417190).